PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02214.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 330aa    MW: 36762 Da    PI: 6.7775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02214.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WTteEd++lvd++++ G g+W++ ++  g++R++k+c++rw +yl
  mrna02214.1-v1.0-hybrid 15 KGPWTTEEDQKLVDYINRNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                             79********************************************97 PP

2Myb_DNA-binding52.98.3e-1768113148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++++eE+  ++++++  G++ W++Ia +++ gRt++++k++w+++l
  mrna02214.1-v1.0-hybrid  68 RGKFSEEEERVIINLHAVVGNK-WSKIATHLP-GRTDNEIKNYWNTHL 113
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3131062IPR017930Myb domain
SuperFamilySSF466894.23E-3112109IPR009057Homeodomain-like
SMARTSM007176.6E-141464IPR001005SANT/Myb domain
PfamPF002491.3E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231669IPR009057Homeodomain-like
CDDcd001672.40E-101762No hitNo description
PROSITE profilePS5129428.59363117IPR017930Myb domain
SMARTSM007171.6E-1667115IPR001005SANT/Myb domain
PfamPF002491.8E-1568113IPR001005SANT/Myb domain
CDDcd001671.97E-1270113No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRSPCCDDQ SGLKKGPWTT EEDQKLVDYI NRNGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEERVII NLHAVVGNKW SKIATHLPGR TDNEIKNYWN THLRKKLLQM  120
GLDPNTHKPR TDLNHLLNLS QLLSMASVGN MVTSNPWDNA VRLQASAAQL SKMQLLQNLY  180
MQVINSSIAT PDIDNKTGIG PFGSQNINLF GGNFNGASSM VDRDQEWDGA SIPGAPNDLN  240
TISNTLEGFE GFNSNINNNC YGMQNFKNQY PELVSSSSPG SSTTNNRIES TSTSDIPDAC  300
QSSPTSIFEA WERLMDDDTS ESYWKNILQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301783.20.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP01e-85MYB39_ARATH; Transcription factor MYB39
TrEMBLM5WRB41e-131M5WRB4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s02240.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-87myb domain protein 9